PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr6P10660_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 283aa    MW: 31890.1 Da    PI: 5.0999
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr6P10660_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.63.8e-1785137456
                            -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            + +++ eq+++Le+ Fe  + +  e++ +LA+ lgL  rqV +WFqNrRa++k
  GSMUA_Achr6P10660_001  85 KKRLNIEQVRTLERNFELGNRLEPERKMQLARVLGLRPRQVAIWFQNRRARWK 137
                            4568889*********************************************9 PP

2HD-ZIP_I/II120.49.6e-3983173191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekk+rl+ eqv++LE++Fe  ++LeperK++lar Lgl+prqva+WFqnrRAR+ktkqlEk+y++Lkr+++a k+ene+L+ ++++L+
  GSMUA_Achr6P10660_001  83 EKKKRLNIEQVRTLERNFELGNRLEPERKMQLARVLGLRPRQVAIWFQNRRARWKTKQLEKEYDVLKRQLEATKTENEALQVQNKKLQ 170
                            69************************************************************************************** PP

            HD-ZIP_I/II  89 eel 91 
                            +e+
  GSMUA_Achr6P10660_001 171 AEI 173
                            987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-1860140IPR009057Homeodomain-like
SuperFamilySSF466898.98E-1978141IPR009057Homeodomain-like
PROSITE profilePS5007116.40679139IPR001356Homeobox domain
SMARTSM003893.4E-1582143IPR001356Homeobox domain
CDDcd000864.11E-1584140No hitNo description
PfamPF000461.5E-1485137IPR001356Homeobox domain
PRINTSPR000312.4E-5110119IPR000047Helix-turn-helix motif
PROSITE patternPS000270114137IPR017970Homeobox, conserved site
PRINTSPR000312.4E-5119135IPR000047Helix-turn-helix motif
CDDcd146860.00878132173No hitNo description
PfamPF021831.4E-10139178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MACNGMASSS SFPSNFMVPM QINCGEENQL GIPVGPLLLA NLQDLRGVPP MMGKISMSFP  60
GIETGDEMTA DDDLSDDGLP AGEKKKRLNI EQVRTLERNF ELGNRLEPER KMQLARVLGL  120
RPRQVAIWFQ NRRARWKTKQ LEKEYDVLKR QLEATKTENE ALQVQNKKLQ AEILALRGGE  180
ASELINLNKE TEGSCSNRSE NSSDINLDIS RTSVTESPLP PHQTLPYFQS VRPADTDLLL  240
HSSCKPEFQC PKVENDEGSF INLLCSMGDQ PAFWPWPDHH NFH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131139RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009404074.10.0PREDICTED: homeobox-leucine zipper protein HOX21-like
SwissprotQ8S7W94e-95HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLM0T5W50.0M0T5W5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P10660_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-84HD-ZIP family protein